PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 1351aa    MW: 149206 Da    PI: 5.1205
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011687genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-183783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
      Lus10011687 37 KGQWTAEEDEILRQAVHRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                     799****************************9.************986 PP

2Myb_DNA-binding65.69.4e-2189135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++v+ v+++G++ W+tIa++++ gR +kqc++rw+++l
      Lus10011687  89 KGPWSKEEDEIIVEMVHKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 135
                      79******************************.*************97 PP

3Myb_DNA-binding45.91.3e-14141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT++E+  lv+a++++G++ W+   + ++ gRt++ +k++w+
      Lus10011687 141 KEAWTQDEEVALVRAHQMYGNR-WAELTKFLP-GRTDNAIKNHWN 183
                      579*******************.*********.***********8 PP

4Myb_DNA-binding45.91.3e-14478520145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT++E+  lv+a++++G++ W+   + ++ gRt++ +k++w+
      Lus10011687 478 KEAWTQDEEVALVRAHQMYGNR-WAELTKFLP-GRTDNAIKNHWN 520
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1713283IPR017930Myb domain
SuperFamilySSF466891.31E-153389IPR009057Homeodomain-like
SMARTSM007171.2E-153685IPR001005SANT/Myb domain
PfamPF002494.2E-163783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-233995IPR009057Homeodomain-like
CDDcd001672.86E-144083No hitNo description
PROSITE profilePS5129433.52884139IPR017930Myb domain
SuperFamilySSF466898.07E-3186182IPR009057Homeodomain-like
SMARTSM007171.4E-1988137IPR001005SANT/Myb domain
PfamPF002495.4E-1989135IPR001005SANT/Myb domain
CDDcd001673.71E-1791135No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2796138IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-20139190IPR009057Homeodomain-like
PROSITE profilePS5129418.789140190IPR017930Myb domain
SMARTSM007172.5E-14140188IPR001005SANT/Myb domain
PfamPF002491.1E-12141184IPR001005SANT/Myb domain
CDDcd001671.08E-10143183No hitNo description
SuperFamilySSF466891.17E-18467528IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-21468527IPR009057Homeodomain-like
PROSITE profilePS5129423.399473527IPR017930Myb domain
SMARTSM007172.5E-14477525IPR001005SANT/Myb domain
PfamPF002491.1E-12478521IPR001005SANT/Myb domain
CDDcd001671.08E-10480520No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1351 aa     Download sequence    Send to blast
MGSDKSFSAP SDGVNDGVQK IRPLHGRTSG PTRRSTKGQW TAEEDEILRQ AVHRFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEII VEMVHKYGPK KWSTIAQHLP  120
GRIGKQCRER WHNHLNPSIN KEAWTQDEEV ALVRAHQMYG NRWAELTKFL PGRTDNAIKN  180
HWNSSVKKKL DSYLASGLLE QFQGLPLVVH QNQPTPSSSS RLQNSGDDND SGRMCGTVAE  240
EISECSQEST VRACSQSAND LGNSIIRSGE EFQLTQDSGH GENQNHHAGN CSVQYYTSRA  300
IVPFSIPEAP FEADCSSNFL QQNYPHIAVN SARADYHVNI VEQGFSGVPN HGIDAHESQE  360
TAKITSHASM SFQGPVPMED MAACSTMREQ IHISDDECCK ILFLETQTVG GNIPQNRMED  420
SHMVDLDGSN HSLPYPSSNN HINPPRCGIL ETQCSQSFPH NLVTPSKWHN HLNPSINKEA  480
WTQDEEVALV RAHQMYGNRW AELTKFLPGR TDNAIKNHWN SSVKKKLDSY LASGLLEQFQ  540
GLPLVVHQNQ PTPSSSSRLQ NSGDDNDSGQ MCGTVAEEIS ECSQESTVRA CSQSANDLGN  600
SIIRSGEEFQ LTQDSGHGED QNHHAGNCSV QYYTSHAIVP FSIPQAPFEA DCSSNFLQQN  660
YPHIAVNSAR ADYHISIVEQ GFSGVPSHGI AAHESQETAN VPSHASMSFQ GPVPMEDMAA  720
SSTTREQILI SDDECCKILF SDAQTVGGNI PQSCMENSHM VDLDESNHAL HYPSSNSHIN  780
PPRCDILETQ CSQSFPHNLV TPSNDENHIC SQKQSQFVTS FGAHDQDFIA SVNDIVFISD  840
DNNVANSFHA NGENNSEMQE ESYLKEASRL VAGDSATLPC PTGVNQKMDV DQQNTGSLCY  900
EPPRFPSLDL PFFSCDLVQS DSDLQQEYSP LGIRQFMMSS VNCISPFRLW DSPTRSSSPD  960
VVLKSAAKTF MGTPSILKKR TRDLLSPLSE RRKDKKLEVD MTSSLTKEFQ RLDVMFEEAE  1020
SRKTHPLSPL SSQKINEVSC SEDKENVDPA LIHGRDGDIV SVDGKEKPRD VSTLSEDDVD  1080
GNNTQENAKK DINCIGPKTE DHSGVDPQIP SEVLDEDSLN DLLLFSPDAQ TPRNWHRRIL  1140
ATLSEKVVNS VSSSGNRSTL SSPAVYKMND GHIVAATETK ANENTVASTG NDGVIGNLNI  1200
FGGTPFKRSI ESPLGWKSPW FINSFVPGPR VDTDISVEDI GYFLSPGDRS YDAITLLKQF  1260
SEHTAAACAD ALEVLGDETP DTISKARHPK NPTSEEEQHD NVSHLANIAT ECRVLDFSEC  1320
GTPEKGRENA KSSPVAISMS SPSCMLKSFR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-68375276159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-68375276159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1989996ERRKDKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516567.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLB9RS480.0B9RS48_RICCO; Myb, putative
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-127Homeodomain-like protein